PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK43613.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 194aa    MW: 22678.7 Da    PI: 5.3596
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK43613.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.99.1e-1384134555
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                 +++rr+++NRe+ArrsR RK+  ++eL   v  L + N+ L ++l++ ++ 
  KFK43613.1  84 RKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRTDNHCLVDKLNRVSES 134
                 79*******************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-1380144IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.15182134IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.0E-1182133No hitNo description
PfamPF001708.2E-1184134IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.98E-1284133No hitNo description
CDDcd147023.68E-1785135No hitNo description
PROSITE patternPS00036087102IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MNTIPAEFTG YFQYNNQTPI MESEHFNMPS SPTSSSSFYY LNGLINNNNN NNNYSSSSNG  60
QDLMTSNNST SDEDHQQSMI IDERKQRRMI SNRESARRSR MRKQRHLDEL WSQVIRLRTD  120
NHCLVDKLNR VSESHELALK ENAKLKEETS DLRQLISEIK SNNEDDNNFL RELEDSISIS  180
RSDSNQRGRD FELC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
196103RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0271340.0AC027134.4 Arabidopsis thaliana chromosome I BAC F13B4 genomic sequence, complete sequence.
GenBankAF3324300.0AF332430.1 Arabidopsis thaliana clone C00105 (e) putative bZIP transcription factor (At1g13600) mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF21F230.0AC027656.4 Sequence of BAC F21F23 from Arabidopsis thaliana chromosome 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172817.21e-115basic leucine-zipper 58
TrEMBLA0A087HNB11e-140A0A087HNB1_ARAAL; Uncharacterized protein
STRINGAT1G13600.11e-115(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28922469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13600.11e-111basic leucine-zipper 58